Recent Comments Join Our Community

dino da vinci:

"Thanks Deep, and will do EM.

Winners will be announced tomorrow evening, Boxing Channel first as the undercard, then the TSS winners as the main event. Unless I have a knee infection, that could prevent my ability to type.

Just effing with you Randy!"

You're a twisted fella, Signore Roast!



I'm reminded that way back in the day when Jews had a higher profile in boxing -- as fighters, spectators, and cornermen -- there were a number of King Solomons' floating around. One fellow billed as King Solomon was exposed as a non-Jewish Panamanian. Back in those days, most local boxing promoters also promoted grunt-and-groan wrestling shows. They had no hesitation in re-inventing a man's lineage if it would sell a few more tickets.



Nice piece. Have always been interested in the geography of boxing. One of the weirdest books in my library of boxing books is by an ex-vaudevillian turned Washington D.C. burlesque house manager: Jimmy Lake. After D.C. legalized boxing in 1934, Lake became the preeminent ring announcer in the area, holding that distinction for more than two decades. He did Louis-Baer I. If you wanted to expand this list to a six-pack, Lake (were he still alive) would nominate the 1939 featherweight title fight at Griffith Stadium between Joey Archibald and Harry Jeffra. Archibald, who was from Providence, was managed by Al Weill and trained by Charlie Goldman, the fellows who would go on to guide the career of Rocky Marciano. Their guy Archibald won a split decision that was so unpopular that there was nearly a riot. The ref, by the way, was the great Benny Leonard, the former lightweight champion. One can be excused for omitting this fight from a list of significant D.C. fights. As champions go, Archibald was a flash in the pan. He lost 26 of his last 32 fights. But for a very brief time he was the generally recognized featherweight champ -- and it happened in Washington DC.



Nice piece. Have always been interested in the geography of boxing. One of the weirdest books in my library of boxing books is by an ex-vaudevillian turned Washington D.C. burlesque house manager: Jimmy Lake. After D.C. legalized boxing in 1934, Lake became the preeminent ring announcer in the area, holding that distinction for more than two decades. He did Louis-Baer I. If you wanted to expand this list to a six-pack, Lake (were he still alive) would nominate the 1939 featherweight title fight at Griffith Stadium between Joey Archibald and Harry Jeffra. Archibald, who was from Providence, was managed by Al Weill and trained by Charlie Goldman, the fellows who would go on to guide the career of Rocky Marciano. Their guy Archibald won a split decision that was so unpopular that there was nearly a riot. The ref, by the way, was the great Benny Leonard, the former lightweight champion. One can be excused for omitting this fight from a list of significant D.C. fights. As champions go, Archibald was a flash in the pan. He lost 26 of his last 36 fights. But for a very brief time he was the generally recognized featherweight champ -- and it happened in Washington DC.


Carmine Cas:

Maidana is simply outgunned and outwitted here, he's going to need every advantage possible. And the general public is catching on so Floyd is going to need to step up his competition.

I think Max Kellerman hit the nail on the head the other day via ESPN, the pressure is on Floyd now.



Gerry seems to calm for Radam! Plus did young Gerry sit on young Ali da GOAT's lap? I don't think so! lol Plus gerry was still fighting when Radam was posting 24/7 (this was before fighters used social media as part of their training camp! :).


The Shadow:

"The intriguing thing about Santa Cruz fighting Rigor is the fact that he says he will do what many at the top level have refused to do. That alone is impressive to me. I won't dump on the kids chances... I don't want to scare off the only guy who's willing to fight. Lol..."

LOL exactly! Bring him on before he changes his mind!

But what happens after this fight, though? Because Rigo WILL rise to the occasion. Every manager and promoter, unless Rigo gets affiliated with Haymon, will run for the hills.


The Shadow:

"And while Maidana has proven himself to be as worthy a challenger as anyone not named Paquiaou.. He's not going to be following a laundry list of instructions and checkpoint maneuvers if plans A, B, and C aren't working.

Maidana will follow Floyd like a videogame sprite,.. taking the shortest route possible.
Upon closing the distance he will rain punches down like a meteor shower.
I have never seen a fighter point his elbow toward the ceiling and punch straight down on an opponents head the way Maidana does.. he usually follows this up with a left to the body or sometimes to the head to change things up..."

B, that is a hilarious description of Maidana's overhand right. Because it is so unconventional and unorthodox, it sort of gave the impression -- qua it's effectiveness vs. Broner's defense -- that this is one of the ways you can break that particular defense.

Again, because Broner, at times, will fight from behind the shoulder and primrily defend flurries behind the shoulder/shell, it will give the casual viewer, and maybe even the seasoned viewer, the impression that the elbow-up, punch-down move works.

It doesn't. Here's why.

Like I pointed out in a different post, and also just now, due to the similar stances, it creates the illusion that Maidana can be effective.

Similarities aside, here are three vital differences between the Broner and Mayweather defense that will ultimately make the difference:

1) Eyes. Floyd's eyes are superior. He will see everything coming as he has more hours of repition doing that style than Broner can ever accumulate for the rest of his adult life.

Research shows that you need 10,000 hours of practice before you master any given discipline. Even if he should work out five hours every day on just that one drill for the rest of his career -- highly unlikely.

I honestly believe, in fact I am quite sure, that Mayweather at 12 was better defensively from that stance than Broner is now. Mayweather at 37 with his athleticism intact? No comparison. He will see everything coming and then some.

The eyes are the foundation, which then leads to the next two key differences in the way sequences unfold in practice:

2) Left hook.

Maidana was able to feint and catch Broner with weird left hooks.

Here's how he set up the first knockdown that changed the complexity of the fight:

Jab to the body. Jab to the body. Move around. Jab to the body. (Condition Broner to expect the jab, parry and deflect he jab, leaving him susceptible to feints and new attacks. One rookie mistake defenders make is over committing your parry, allowing the attacker to turn that jab into a hook. It's as intermediate-elementary as it gets.) Jab. Feint. Throw the jab to the body and AT THE LAST SECOND -- as Broner's right hand is down by belly -- turns it into a hook upstairs.

A wonderful setup, yes. But also an exploitation of defensive deficiency -- one Floyd at 16 would never, ever have shown, let alone the Floyd of today.

He doesn't get caught by incoming left hooks by mistake except for the occasional left hook to the body. To the head is a statistical anomaly. (Maidana still must try, though.)

3) The elbow pointer overhand right.

Quite simply, this won't work. Here, the main -- and most glaring -- difference between Mayweather and Broner (or most who try that defense for that matter eg Berto) is that when an overhand right comes, they're suckers for it because you don't really roll an overhand. You roll a straight one.

Lots of people mistakenly think all Floyd does is roll. Couldn't be farther from the truth. Sane Mosley and Sugar Ray Leonard pointed this out in a recent interview as well.

Watch Floyd vs. Baldomir who tried this overhand nonsense repeatedly and then compare Broner. Broner would try to roll from those overhand rights which just gave Maidana a better target. When that didn't work, he would lean, providing an even better target. LOL.

Floyd does one simple thing here: he dips. If he doesn't dip, he ducks. From there, he can counterpunch, pivot out, tie you up or tie you up-punch you in the gut and thereby discouraging this attack.

There are few things more discouraging than being punched in the gut when you least expect it.

In short, Broner would limit his options because he didn't have the necessary experience and know-how to create them. Floyd will not only defend, but he will give himself at least 2-3 options out of every defensive sequence.

Overall, this leads me to the conclusion that what whatever worked vs. Broner won't work vs. Mayweather.

What's really sad is the way in which Maidana will likely lose will minimize everyone's accomplishments:

- Maidana sucks...

- Broner wasn't that good anyway...

- Floyd is a cherry picker, Maidana lost to Devon Alexander... (It's his second unification fight in a row but he's cherry picking the guy fans voted for in the first place. OK, whatever...)

Every man deserves credit here. Maidana is terrorized. Broner is a three-weight titlist. And Mayweather is just that damn good.

The end.



Yes it is really tiresome because it has the potential to control and change all or most aspects of the life you have fought and worked so hard to achieve.

And usually it involves people telling you what you can and can't do, and it costs you a fortune and turns you into someone whom doesn’t know who he can trust; as often the person you're paying for advice is looking out for themselves.

There’s a reason they say that only the lawyers ever win.

There are many other factors, but just the above is enough to drive you nuts.

When was the last time you enjoyed someone telling you - with serious authority - what you can and can't do and making sure you do it regardless of all the facts and what’s right and wrong?

Now imagine having to pay thousands of dollars for the “privilege” and possibly also suffering public embarrassment over it.

Boxing, to a large extent is psychological, and these kinds of problems eat at you to the point where they can impact your confidence and performance.

And yes Ward would be bothered about it. That’s why he doing something about it.

Very few boxers, by their nature, like to be ripped off and/or told what to do - particularly when it comes to their career.

Yet, just when they finally make it to the level where they can earn serious money - that is reasonable money that allows them to get ahead after everyone takes their cut - that’s when they find themselves reading the most writs and subpoenas.

Add to it all, very boxers have a business background, let alone are legally savvy.

So, it comes as a real shock to the system to find that someone is possibly, in their terms, ripping them off, and they can’t deal with it in the usual manner.

As they say the pen is mightier than the sword and there is a reason Don King, bob Arum and many others don’t care how good you can fight in the ring.

Once you have to go and see a lawyer in order to understand your future, you will understand what I mean and why Arum and others like him walk around at promotional events as if they're the heavyweight champion; regardless of the fact that they can't do 1 single one minute round with a flyweight.



"I'll counter it with a *sniff*"

What does that mean?



The intriguing thing about Santa Cruz fighting Rigor is the fact that he says he will do what many at the top level have refused to do. That alone is impressive to me. I won't dump on the kids chances... I don't want to scare off the only guy who's willing to fight. Lol...



At some point Maidana needs to attack like he did with Broner, concentrating on a body attack. Hopefully, he watched Bradley's dubious strategy against

Pacman and won't repeat that. But he does need to get Floyd to respect his punch or he's in for a long night.



"Mayweather highlights or watch that elbow - YouTube
► 5:58► 5:58
Feb 25, 2009 - Uploaded by Axtox
Mayweather highlights or watch that elbow.
You are right. Watch this clip. You are proven correct without a shadow of a doubt. If anyone can counter this clip with a logical explanation I will be surprised and astounded"

Hatton wasn't boxing... He was mauling and brawling.... Utilizing the same king of strategy wounded animals do at the humane society.

The ref had lost control of a very pumped up Rickey Hatton. Floyd was lucky he knew what to do in what was virtually a street fight.

At least thats my humble opinion.... Thanks for the video.



Its interesting to me that there has been little to no promotion for this fight.. So Im guessing this strategy posted by Garcia is probably designed to encourage support for the premise that Maidana will actually have a winning strategy.

And while Maidana has proven himself to be as worthy a challenger as anyone not named Paquiaou.. He's not going to be following a laundry list of instructions and checkpoint maneuvers if plans A, B, and C aren't working.

Maidana will follow Floyd like a videogame sprite,.. taking the shortest route possible.
Upon closing the distance he will rain punches down like a meteor shower.
I have never seen a fighter point his elbow toward the ceiling and punch straight down on an opponents head the way Maidana does.. he usually follows this up with a left to the body or sometimes to the head to change things up.

While Maidana usually relies on a seek and destroy strategy...., he does incorporate boxing fundamentals into his attack . But his ultimate purpose is to create chaos and disrupt his opponents rythym with his own special. "Welcome to my World" brand of pugilistic terror.

Maidana knows he will probably miss the first punch...but once he traps his opponent, Maidana is likely to land the 3rd, 5th, or 6th punch. If his opponent tries to fire back... Maidana answers back with maniacal glee......ecstatic to trade in a gamble that he will get their first.

I like the Good Doctors plan. Its as good a plan hypothetically as anybody is likely come up with... And there have been thousands.

My question is .........."who is going to carry out that plan?"

Make no mistake ... From the opening bell Maidana seeks to do one thing, close the distance, his second objective is to make contact, ....just wanting to touch his opponent.
Thirdly on the list ..... Connect. ......He wants to hit you with a punch thrown from Argentina.

No further complexity needed or taken by the South American Whirlwind.

If that doesn't work he will take a deep breath between rounds .... Bite down hard on his mouthpiece and and just try harder the next round.

Maidana was, is, and ever will be an engine of destruction, cutting a swathe of disruption and chaos to his opponent.

I think this will be an interesting fight where Mayweather will go into extermination mode. Maidana is not the kind of fighter you want to let hang around for 12 rounds if you have a better option.


The Shadow:


Gamboa looked to be in a good legal position as he really didn’t commit to the Rios fight and Bob (in my view) blinded home with legal BS and red tape.

Of course Arum put Gamboa’s career on freeze also, and that became such a big thing that winning the ever increasingly stressful court case soon got relegated to second priority.

In fact, I heard that Gamboa was so stressed about it that training was hard also.

Makes sense when you're unable to do all you know and have defected for in your defected country and your homeland Cuba hates you and would love to see you deported.

Legal matters have a habit of trying your resilience in ways that make boxing seem easy. Trust me I know.

Garcia(s) have been smart about this one though.

They haven’t pulled the pin on TR until there are several legal points of note (Ali act, 7 years expired . . etc) and all that, and of course until they have other promotional options, of which the Maidana fight presents as one example.

What a coincidence that Robert is now in business with Al Haymon and Floyd, and now they are looking at how TR has not complied with the law and its own contract."

Is legal stuff really that bothersome? Can you shed some light on that, please? The thought process, how it might discourage you and so forth.

How do you think Andre Ward feels right now?


The Shadow:

"I think Rigo would probably welcome that approach.

He wouldn’t have to look for openings and/or opportunities."

Exactly. LSC would get blitzed.

And re: your other post, we both know because you have told me.


The Shadow:

Amayseng, I feel you. Bt I actually think this whole 12-step, AA, rehab, gratitude, positive self-affirmation trip is what defines him now.

Nowadays, with people "thinking out loud" all the damn time on social media, it's easy to see what consumes a man's mind.

He never struck me as an egomaniac. It's impossible to have Floyd Sr. as a trainer if that is the case. Because he might have the biggest ego in boxing.

Yet, Oscar was ok with having Floyd be the boss and try to upstage the fighters at press conferences. So I don't get that lust for fame vibe from him.

Maybe he just needs a new outlet. Perhaps he should go back to making maricon records?


The Shadow:

"Mayweather highlights or watch that elbow - YouTube
► 5:58► 5:58
Feb 25, 2009 - Uploaded by Axtox
Mayweather highlights or watch that elbow.
You are right. Watch this clip. You are proven correct without a shadow of a doubt. If anyone can counter this clip with a logical explanation I will be surprised and astounded"

I'll counter it with a *sniff*



"In response to a couple of comments I'll say this. When Mayweather fought Ricky Hatton the ref would break the fighters apart every time Hatton got inside and Mayweather tried to clinch. Had Hatton been able to fight his fight it may very well have ended up with a different result. Anyone who doubts me just might watch that fight again, or for the first time, with an eye towards what I just said. If Maidana draws a better ref and is allowed to fight inside he might just have the right tools and game plan to win the fight. I'm hoping so anyway, but in my quest to see a Mayweather /Pacquiao fight I will wait until after the fight and download it for dissection later.

Jerry Lynch"

Mayweather highlights or watch that elbow - YouTube
► 5:58► 5:58
Feb 25, 2009 - Uploaded by Axtox
Mayweather highlights or watch that elbow.
You are right. Watch this clip. You are proven correct without a shadow of a doubt. If anyone can counter this clip with a logical explanation I will be surprised and astounded



"I like breaking the bones lol

I also like the jab-hook that Maidana used against Broner

He's got to pump that jab and move to his right.

And Deep made a great point about consulting with the ref prior to the bout regarding the forearm."

Thanks. Chinos camp should bring an iPad into the rules meeting and the dressing room before the fight. Show video of Floyd's illegal forearm and bring it to light.sound like a broken record. Garcia should also have chino hook the elbow/forearm and pull it forward while shooting low blows on the other side of the ref. it really is the art of war in there. If Garcia can get any advantage he must take it. Floyd is gonna jab that body all night so chino better have counter measures



I don't see Oscar fading away by choice. Being a superstar, idol and center of attention for 20 years it is hard for his ego to give that up. No longer being that in the ring he still will not relinquish that outside the ring until his health forces him to.

In fact I am surprised he did not come back and fight again a few more times before 40.

If it was not for his drug addiction then I assume he would have without a doubt.

This is all he has, he may( or may not) be a loving husband and father but those aren't the things that consume/define him as a human being, it is being a star in the limelight, one way or another.



"Oscar still has the lead in net worth.

I've posted here in the past that I'm stunned Oscar is still promoting this far down the road. I suspected he'd have long gotten bored and walked, which, because he's still here, may be a testament to Richard, or not. :-)"

You might be right . I'm rooting for Oscar to come out of this ok. I was a big fan of his and enjoyed his fights .He really put on a great show and fought the best. I really believe he wants to end the Cold War with top rank and make the best fights to help the sport. When he formed GBP he brought in Hopkins,Barerra,Mosley,Hatton and Wright and wanted an outfit run by fighters to elevate the sport. This is America ,the land of second chances. He can come back from that coke stuff like a lot of people do.


Radam G:

What about the money under the table. Hehehe! The step aside loot and all of that poop. Haha!

Good one, tR. I need a pair of socks and a knee brace. Last time time, I hurt my doggs. This time, it was my leg calf. And now, I feel my left knee going out. :D Holla!



"Oscar still has the lead in net worth.

I've posted here in the past that I'm stunned Oscar is still promoting this far down the road. I suspected he'd have long gotten bored and walked, which, because he's still here, may be a testament to Richard, or not. :-)"

Right.... But despite Oscars many public indescretions, his former fame and glory is the blueprint that attracts and inspires a near bottomless pool of aspiring Hispanic amateurs to go pro under the GB banner. Oscar has many off and on TV events competing for airtime on Mexican TV..and the Hispanic channel... hardly a week( or in some cases a month) goes by without a GB show on Latino TV. I don't know who does the grunt work but you can be sure that Oscar is the one glad handing the new prospects at some upscale restaurant while welcoming them to a life of privelege, access and economic success.


dino da vinci:

Oscar still has the lead in net worth.

I've posted here in the past that I'm stunned Oscar is still promoting this far down the road. I suspected he'd have long gotten bored and walked, which, because he's still here, may be a testament to Richard, or not. :-)


The Commish:

Lol, Roast. I know that. If I had told Arthur Mercante Jr. I was having knee problems he would have said, "Be a man. Suck it up. You're a champion. Act like one!"

By the way, the knee is much better (not 100% yet), but I am a few minutes away from giving a class at Lifetime Fitness in Syosset, L.I. Wish I could put all of you boxing wackos into the room this morning and make you sweat!

Yopu did a great job as Moderator. We all thank you.

-Randy G.


Radam G:

"Are you Gerry ?"

Hehe! No I'm not Gerry P. Holla!



Are you Gerry ?



"In response to a couple of comments I'll say this. When Mayweather fought Ricky Hatton the ref would break the fighters apart every time Hatton got inside and Mayweather tried to clinch. Had Hatton been able to fight his fight it may very well have ended up with a different result. Anyone who doubts me just might watch that fight again, or for the first time, with an eye towards what I just said. If Maidana draws a better ref and is allowed to fight inside he might just have the right tools and game plan to win the fight. I'm hoping so anyway, but in my quest to see a Mayweather /Pacquiao fight I will wait until after the fight and download it for dissection later.

Jerry Lynch"

Oh, I almost forgot - and I don't want to let you off too lightly . . . . . . :) :)

If you have a look at Kostya Tszyu V Hatton you will see a plethora of dirty tactics.

Let’s just for a minute assume I am Kostya Tszyu.

If I were Kostya Tszyu I would know that every time we’re separated I am lighting up Ricky as he comes in with that freckled face. But, his smothering and wrestling tactics I am not used to.

I know Ricky is keeping things on the inside and my inside game slipped a little since JCC, but every time Ricky is in there he’s wrestling, holding and smothering and Parris is doing zip about it.

After the difficulties associated with making weight, all Hatton’s low blows and all the other above-mentioned and questionable tactics are considered; I'm probably getting pretty frustrated with Parris and Ricky.

I know I am dominating Ricky every time we’re separated but those times - thanks to Parris - are becoming less frequent than when I am being wrestled.

At the end of the day I am a pure boxer, not a wrester and I can't fight the referee (Parris) and Ricky.

Still, at the end of the day, the best man won on his own turf that night and I have no regrets.

Watch the Kostya Tszyu V Ricky Hatton fight-video and then tell me that Ricky is not dirty and has the right to call out Mayweather for being so.



"Storm, too much gold to address with just one brief post.

Indeed, you're right. The Golden Boy brand isn't valuable because of Oscar. It's valuable IN SPITE of Oscar who has since become a liability due to his drug use.

He's a joke, more or less, among media. Corporations don't respect him as he doesn't have a Q-rating of note anymore. He doesn't generate big money anymore; Floyd does.

Oscar on his own can do nothing. He's not particularly bright. He doesn't have all the right relationships; Schaefer and Haymon do. "

Yep, you're right.

It's hard to knock a man when he's down and he's the one that helped you (Schaefer didn't give up his Swiss Bank LA and UBS roles because he could make less with GBP), and drilling Oscar right now whilst he recovers from drug issues wouldn't look or be right.

But no-one can say that in the glitzy world of big business, PPV broadcasting and global promotions, Oscar's image really needs a rethink.

He does not come across as a marketable or believable guy anymore, and whilst he may have thought that he had the casting sorted, having Schaefer in the office has worked a treat because it is Oscar that has had to sell the fights, and since Oscar/GBP have mostly made their cash off of trying to beat Floyd; all Oscar's predictions (in relation to their fighter's fighting Floyd) have done is show the world how misleading, jaded and incorrect Oscar really is.

Combined with the fish net stockings, and other "adventures" Oscar had people are now less forgiving about how managed his career really was.

Think about it. His boxing partner (Hopkins) is everything Oscar aspired to be. But, he, like Floyd, beat Oscar. In fact, Bernard exposed and flogged Oscar.

Also, without the Schaefer and Mayweather association it is doubtable that GBP would be so successful. But, Floyd (whilst not flogging Oscar physically) just outclassed him after a tour that thoroughly embarrassed him.

So Oscar lives everyday in the "Shadow" (just thought I would throw that name in there for you :) ) of the 2 guys that exposed him. Almost as if he is defined by his losses and useless without them.

And with every prediction of his fighter against Floyd that went successively wrong the paranoia set in and played havoc with what was once probably a casual habit.

Now things have got to a point where Oscar and GBP - at least in terms of competing as a PPV entity (which really where the big money, boys, business and reputation for promoters really is) - are effectively reliant upon Floyd Mayweather.

And that relationship will not exist without Richard Schaefer.

So, in some ways, Oscar controls nothing and has the responsibility for everything.

This is the business equivalent of wearing women's clothing and snorting cocaine whilst pretending to be the toughest prizefighter out there.

Funny that.

And in this way, Floyd is the antithesis of all Oscar is.

He controls what matters of GBP. He has beaten Oscar in every way; popularity, fighting, wealth (probably) and most importantly he has proven that he is an authentic fighter that can rule the ring even though his matchmaking comes under scrutiny.

In Oscar's mind Floyd owns him and that bothers him to the point where his conduct, mouth and business moves are not always as controlled as Schaefer or Oscar himself would like.

" Oscar's value to a promotional outfit is adding that fighter dimension the suits lack. That helps with recruitment and building trust. But he has no corporate clout.

His lack of reliability due to his addictions don't exactly make things better, either.

In fact, they would be wise to just phase out any reference to Golden Boy and refer to it as GBP. This they can do with or without Oscar De La Hoya.

"Global Boxing Productions" or "Global Boxing Partners." It wouldn't even be infringement.

I think the only sticking point is the fighter contracts, which at the end of the day are the main assets of the promoter.

So Oscar, as the majority shareholder, has leverage there, I would think.

I do think that had Schaefer had those rights, beef with De La Hoya would've led to Richard just breaking ties. But for now, everyone is best served getting along.

By the way Storm, since I know who you are, do you mind sending that article over via PM?

And you're right -- there are no ethics to violate so what the heck is the problem."

Hopkins, should he roll over to Showtime, Haymon or any other promotional outfit with Schaefer - if he is considering it - or even if they use Hopkins as the main fighter-dimension for now; easily serves as a better boxing mascot for GBP right now.

He doesn't make silly predictions. He fights well. He only talks too much. But then, he is a living legend whose record looks impressive even if you don't read it, as there are so many titles there it's like he easts world champions for breakfast.

I think Oscar would have himself tied into the company pretty well from a legal perspective, but should Schaefer decided to roll as above described or similar; I doubt that Oscar would continue as a promoter.

He would just fade into the distance as another wealthy fighter/promoter who did well for themselves. It would be a bittersweet existence for him as many would say "you have all that life could offer" whilst he himself would always be eaten away with what was unobtainable and the mistakes.

Such is success and fame, boxing and Floyd Mayweather.

I actually don't know where the Dettlof article is. I don't have a copy of it.

Happy to have you PM me on who you think I am.



payperviewslessismoregiveourwalletsabreak Top Articles
Pay-Per-Views: LESS IS MORE, Give Our Wallets A Break!

So I clicked the "power" button on my remote control on Saturday night, and brought up the program guide, and scrolled down to the 300s, where the pay-per-view offerings lie. I went past the true red light district, the filthy titles, and settled on the In Demand region. I found that Manny Pacquiao-Timothy Bradley Top Rank/HBO PPV offering, gulped at the $69 price tag and pressed "buy and record." I could have not done that. But I'm a fight fan, and enjoy watching the biggest bouts, and beyond that, I am duty bound to do so, as the editor...

Read the full story by Michael Woods
dannyjacobsaddedtoshowtimeannounceteamfordccard Press Release
Danny Jacobs Added To Showtime Announce Team For DC Card

MIDDLEWEIGHT CONTENDER DANIEL JACOBS TO SERVE AS SHOWTIME CHAMPIONSHIP BOXING® GUEST ANALYST FOR THIS SATURDAY’S WORLD CHAMPIONSHIP TRIPLEHEADER Saturday, April 19, LIVE on SHOWTIME® (9 p.m. ET/PT, delayed on the West Coast) Immediately Following Episode 1 Premiere of ALL ACCESS: MAYWEATHER vs. MAIDANA WASHINGTON, D.C. (April 16, 2014) – Middleweight contender Daniel Jacobs is trading in his gloves for a microphone, at least for one night. The inspirational cancer survivor will serve as guest analyst for this Saturday’s SHOWTIME...

Read the full story
lookslikemikeygarciaisfightinghispromotertoprank Top Articles
Looks Like Mikey Garcia Is Fighting His Promoter, Top Rank

During a Tuesday early evening phone call, trainer Robert Garcia said brother Mikey is looking, perhaps, at a July date, against TBD. The Cali based tutor talked to TSS about Marcos Maidanas' chances of beating Floyd Mayweather, and then we followed up with a question about lil bro Mikey, who holds the WBO super feather title. I asked Robert if the 26-year-old Mikey, who boasts a 34-0 record, would be looking to lock down a signature fight next, and, maybe, be seeking to step up his game where he's fighting more minutes of each round with...

Read the full story by Michael Woods
robertgarciasharesonhowmaidanawillaimtobeatfloyd Top Articles
Robert Garcia Shares On How Maidana Will Aim To Beat Floyd

Lot of people out there thinking he's got to land that lucky punch, that hail mary bomb delivered with bad intentions and a prayer. Lot of people thinking Marcos Maidana (35-3 with 31 KOs; age 3; on a four-fight winning streak) will be throwing nothing but bombs from second one against Floyd Mayweather on May 3 at the MGM, and on Showtime pay-per-view...but his trainer, Robert Garcia, tells me that isn't so. Yes, Garcia said during a Tuesday night phoner, Maidana has been training thus far with the intention of throwing about 120 punches a...

Read the full story by Michael Woods
gargantuanheavyweightscharlesmartinaalexfloresbattleinsantamonicabeach Top Articles
Huge Heavys Charles Martin & Alex Flores Battle in Santa Monica Beach

A new promotion company has emerged in the boxing world and they’re coming with the big boys. King Sports intends to battle with the bigger kids on the block in the boxing world and they’re bringing gargantuan Charles Martin (15-0-1, 13 Kos) to fight the equally towering Alex Flores (14-0, 12 Kos) on Wednesday, April 16. The fight card takes place at Barker Hangar in Santa Monica. The vacant WBO NABO heavyweight title will go to the winner. Investing in heavyweights has been a goal for several years by Michael King, who heads King...

Read the full story by David A. Avila
whatsnextforpugilistspecialistrigondeaux News
What's Next For Pugilist-Specialist Rigondeaux?

He might well be the best pure pugilist on the planet. His ability to execute his gameplan, with subtle brilliance, doesn't go unnoticed by a multitude of fight fans. However, in a world which seems increasingly to punish subtlety, and reward excess, the over the top, Guillermo Rigondeaux is, while being regarded almost universally one of the top pound for pound talents, is still finding his place, clarifying his role in the fightgame milieu. The clarification process will proceed on July 19, on a Macau card promoted by Top Rank. I reached...

Read the full story by Michael Woods
dawejkofihgtsrideoutmay16insouthphilly Press Release
Dawejko Fights Rideout May 16 in South Philly

HEAVYWEIGHTS DAWEJKO, RIDEOUT COLLIDE ON MAY 16 FIGHT CARD AS 2300 ARENA IN SOUTH PHILLY Philadelphia, PA—Heavyweights JoeyDawejko and Mark Rideout meet over eight rounds—or less—in an all-Philadelphia match on Friday evening, May 16, at the 2300 Arena in South Philadelphia. Topping the seven-bout card is an eight-round between undefeated junior welterweight prospects Naim Nelson, of Philadelphia, and Jerome Rodriguez, of Trenton, NJ. The seven-bout card program marks the first pro fight card at the 2300 Arena since Jan. 21,...

Read the full story
thenightbernardhopkinswonthemiddleweighttitle Top Articles
The Night Bernard Hopkins Won the Middleweight Title

Bernard Hopkins is a Philadelphia fighter, but has a special history with Washington, D.C. When he announced his upcoming light heavyweight title unification bout with Belbut Shumenov, taking place at the D.C. Armory on Saturday, April 19, Hopkins alluded to his experiences fighting in the District. “Here in D.C. you're only as good as your last vote,” said Hopkins. “At the end of the day, I've realized that you can be a champion yesterday, but if you dwell on yesterday you will never go forward.” To be fighting at his level at 49,...

Read the full story by Aaron Tallent
quiggfightsmunyaisaturdayonawe Press Release
Quigg Fights Munyai Saturday, on AWE

SAN DIEGO (APRIL 14, 2014)--This Saturday afternoon, Tshifiwa Munyai will step in for Nehomar Cermeno to challenge Scott Quigg for Quigg's WBA Super Bantamweight title that will be broadcast live on AWE beginning at 3pm eastern / 12 noon pacific. Boxing fans across the United States can enjoy this world championship bout live via the PlayStation®3 system via the Sony Entertainment Network Live Events Viewer. The price is $9.95 for approximately three hours of world class boxing which includes the Quigg - Cermeno main event. PS3 viewers may...

Read the full story
quillinvictimofcoldwarwantsgggsergiostill News
Quillin Victim Of Cold War, Wants GGG, Sergio Still

Undefeated world champion Peter 'Kid Chocolate' Quillin Fighting for respect NEW YORK CITY (April 14, 2014) - Undefeated World Boxing Organization (WBO) middleweight champion of the World, Peter "Kid Chocolate" Quillin, is fighting for respect this Saturday night on SHOWTIME against No. 2 ranked Czech challenger Lukas Konecny (50-4, 23 KOs). Quillin vs. Konecny is part of a Golden Boy Promotions event, sponsored by Corona and AT&T, and headlined by the world light heavyweight unification fight between IBF champion Bernard "The...

Read the full story
goldenboyreturningtobostonjune5athouseofblue News
Golden Boy Returning To Boston; June 5 at House of Blues

GOLDEN BOY LIVE! RETURNS TO BOSTON; NABA SUPER FEATHERWEIGHT CHAMPION LOGAN MCGUINNESS PUT HIS TITLE ON THE LINE AGAINST MIKE OLIVER ON THURSDAY, JUNE 5 LIVE ON FOX SPORTS 1 AND FOX DEPORTES FROM THE HOUSE OF BLUES IN BOSTON TICKETS ON SALE NOW! BOSTON (April 14, 2014) - After an exciting night of fights in Boston on St. Patrick's Day, Golden Boy Promotions will return to this boxing rich town to team up with Murphy's Boxing U.S.A and Back East Promotions on Thursday, June 5 with a stacked card at the House of Blues featuring a title...

Read the full story
wednesdaypressertotoutprovodnikovalgieriatbarclays Press Release
Wednesday Presser To Tout Provodnikov-Algieri at Barclays

Philadelphia (April 14, 2014)--Barclays Center and Banner Promotions will host a press conference to announce the WBO junior welterweight title fight between champion Ruslan "The Siberian Rocky" Provodnikov of Beryozovo, Russia and Chris Algieri of Huntington, Long Island on Wednesday, April 16. The fight will take place Saturday night, June 14, and will be televised liveon HBO Boxing After Dark. Provodnikov - Algieri will headline a championship night of boxing. A strong undercard will include the WBC Continental America's...

Read the full story
freddieroachassessesmannyseffortbradleyscalfexcuse Top Articles
Freddie Roach Assesses Manny's Effort, Bradley's Calf Excuse

Freddie Roach on Monday morning, after he'd slept on it, gave his guy Manny Pacquiao high marks for doing his thing against Timothy Bradley at the MGM in Las Vegas on Saturday night. "It was a good fight," Coach Roach told me, on the phone, while working with Miguel Cotto at Wild Card, counting down to the Puerto Rican's June test against Sergio Martinez in NYC, at MSG. "The first part of the fight was pretty even, I had it 3-3, but Manny was pretty much dominant the last six rounds." Roach said Pacman complained to him, around round five,...

Read the full story by Michael Woods
battlehymnpart8shadowandlight Top Articles
Battle Hymn - Part 8: Shadow and Light

When Aaron Wade left San Francisco in 1945, he left behind a son and a pregnant wife. “He didn’t want to be a family man,” Jenny said. “He didn’t want nothing.” Right around the time he took a dive against Sugar Ray Robinson in February 1950, Alan Roy Wade turned four and had yet to meet him. By then, Jenny had given up and filed for divorce. It was finalized that year. Wade moved in with a girlfriend in Jersey City and got a job at the Department of Sanitation. There were half-hearted attempts to reach out to his sons and every...

Read the full story by Springs Toledo

Fight Results

FIGHTER Result Rnd

Manny Pacquiao

Timothy Bradley

UD R12

Ray Beltran

Arash Usmanee

UD R12

Jessie Vargas

Khabib Allakhverdiev

UD R12

Bryan Vasquez

Jose Felix Jr.

UD R12

Fight Schedule

Zona de Boxeo
Subscribe to
Boxing Cartoons
Live Boxing Coverage

Who will win #MayweatherMaydana?
